SCOPe 2.07: Domain d5twea_: 5twe A:

Lineage for d5twea_ (5twe A:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (30 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187306] (106 PDB entries)

8. Domain d5twea_: 5twe A: [336252]
   automated match to d4pm5a_
   complexed with caz; mutant

Details for d5twea_

PDB Entry: 5twe, 1.5 Å

PDB Description: ctx-m-14 p167s:s70g mutant enzyme crystallized with ceftazidime

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5twea_:

Sequence; same for both SEQRES and ATOM records:

>d5twea_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqset
qkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
gvtafaraigdetfrldrtestlntaipgdprdtttpramaqtlrqltlghalgetqraq
lvtwlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftqp
qqnaesrrdvlasaariiaegl

Timeline for d5twea_:

• d5twea_ first appeared in SCOPe 2.06
  
• d5twea_ appears in the current release, SCOPe 2.08