Lineage for d5vtva1 (5vtv A:11-329)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2370814Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2370815Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2371474Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2371475Protein automated matches [227017] (39 species)
    not a true protein
  7. 2371579Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327808] (14 PDB entries)
  8. 2371586Domain d5vtva1: 5vtv A:11-329 [336250]
    Other proteins in same PDB: d5vtva2, d5vtvb_, d5vtvc2, d5vtvd_, d5vtve2, d5vtvf_
    automated match to d4xkga_
    complexed with bma, gal, man, nag, sia, tam; mutant

Details for d5vtva1

PDB Entry: 5vtv (more details), 2.25 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin g225m/l226t/s228a mutant in complex with 3'-sln
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d5vtva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vtva1 b.19.1.0 (A:11-329) automated matches {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal
lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv
tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqe
qtslyvqasgrvtvstrrsqqtiipnigsrpwvrmtsarisiywtivkpgdvlvinsngn
liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk
qntlklatgmrnvpekqtr

SCOPe Domain Coordinates for d5vtva1:

Click to download the PDB-style file with coordinates for d5vtva1.
(The format of our PDB-style files is described here.)

Timeline for d5vtva1: