![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) Pfam PF00665 |
![]() | Protein Retroviral integrase, catalytic domain [53108] (5 species) |
![]() | Species Rous sarcoma virus RSV [TaxId:11886] [53109] (23 PDB entries) |
![]() | Domain d1vsda_: 1vsd A: [33625] complexed with epe, mg |
PDB Entry: 1vsd (more details), 1.7 Å
SCOPe Domain Sequences for d1vsda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vsda_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Rous sarcoma virus RSV [TaxId: 11886]} glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg dgfmkriptskqgellakamyalnhf
Timeline for d1vsda_: