Lineage for d5vtqa1 (5vtq A:11-329)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2047495Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2047496Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2048164Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2048165Protein automated matches [227017] (34 species)
    not a true protein
  7. 2048261Species Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327808] (11 PDB entries)
  8. 2048292Domain d5vtqa1: 5vtq A:11-329 [336243]
    Other proteins in same PDB: d5vtqa2, d5vtqb_, d5vtqc2, d5vtqd_, d5vtqe2, d5vtqf_
    automated match to d4xkga_
    complexed with bma, gal, man, nag, sia; mutant

Details for d5vtqa1

PDB Entry: 5vtq (more details), 2.95 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin g225l/l226s mutant in complex with 3'-sln
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d5vtqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vtqa1 b.19.1.0 (A:11-329) automated matches {Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal
lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv
tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqe
qtslyvqasgrvtvstrrsqqtiipnigsrpwvrlsssrisiywtivkpgdvlvinsngn
liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk
qntlklatgmrnvpekqtr

SCOPe Domain Coordinates for d5vtqa1:

Click to download the PDB-style file with coordinates for d5vtqa1.
(The format of our PDB-style files is described here.)

Timeline for d5vtqa1: