Lineage for d5o0fb_ (5o0f B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2443142Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2443143Protein automated matches [190459] (53 species)
    not a true protein
  7. 2443293Species Mycobacterium abscessus [TaxId:561007] [312100] (12 PDB entries)
  8. 2443314Domain d5o0fb_: 5o0f B: [336234]
    automated match to d4rukb_
    complexed with iop

Details for d5o0fb_

PDB Entry: 5o0f (more details), 1.7 Å

PDB Description: crystal structure of phosphopantetheine adenylyltransferase from mycobacterium abcessus in complex with 3-(indol-3-yl)propanoic acid (fragment 5)
PDB Compounds: (B:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d5o0fb_:

Sequence, based on SEQRES records: (download)

>d5o0fb_ c.26.1.0 (B:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
mtgavcpgsfdpvtlghldvferaaaqfdevivavlinpnkagmftvderiemirestad
lpnlrvesgqgllvdfvrerglnaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
aysfvssslakevatyggdvsallpasvhqrllgklr

Sequence, based on observed residues (ATOM records): (download)

>d5o0fb_ c.26.1.0 (B:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
mtgavcpgsfdpvtlghldvferaaaqfdevivavlinpagmftvderiemirestadlp
nlrvesgqgllvdfvrerglnaivkglrtgtdfeyelqmaqmnkhiagvdtffvatapay
sfvssslakevatyggdvsallpasvhqrllgklr

SCOPe Domain Coordinates for d5o0fb_:

Click to download the PDB-style file with coordinates for d5o0fb_.
(The format of our PDB-style files is described here.)

Timeline for d5o0fb_: