| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
Superfamily d.13.1: HIT-like [54197] (6 families) ![]() |
| Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins) Pfam PF01230 topologically similar to the N-terminal domain of protein kinases |
| Protein automated matches [191082] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189791] (32 PDB entries) |
| Domain d5o8ia_: 5o8i A: [336229] automated match to d3tw2a_ complexed with adp |
PDB Entry: 5o8i (more details), 1.27 Å
SCOPe Domain Sequences for d5o8ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o8ia_ d.13.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaeddde
sllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg
Timeline for d5o8ia_: