Lineage for d1cxqa_ (1cxq A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25212Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) (S)
  5. 25292Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (1 protein)
  6. 25293Protein Retroviral integrase, catalytic domain [53108] (3 species)
  7. 25321Species Rous sarcoma virus (RSV, avian sarcoma virus) [53109] (21 PDB entries)
  8. 25322Domain d1cxqa_: 1cxq A: [33621]

Details for d1cxqa_

PDB Entry: 1cxq (more details), 1.02 Å

PDB Description: atomic resolution asv integrase core domain from ammonium sulfate

SCOP Domain Sequences for d1cxqa_:

Sequence, based on SEQRES records: (download)

>d1cxqa_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Rous sarcoma virus (RSV, avian sarcoma virus)}
grglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiav
lgrpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvla
egdgfmkriptskqgellakamyalnh

Sequence, based on observed residues (ATOM records): (download)

>d1cxqa_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Rous sarcoma virus (RSV, avian sarcoma virus)}
grglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiav
lgrpkaiktdngscftskstrewlarwgiahttgipgqamveranrllkdkirvlaegdg
fmkriptskqgellakamyalnh

SCOP Domain Coordinates for d1cxqa_:

Click to download the PDB-style file with coordinates for d1cxqa_.
(The format of our PDB-style files is described here.)

Timeline for d1cxqa_: