Lineage for d5u7ia_ (5u7i A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349642Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2349643Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2350180Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2350181Protein automated matches [190983] (10 species)
    not a true protein
  7. 2350200Species Human (Homo sapiens) [TaxId:9606] [188676] (136 PDB entries)
  8. 2350375Domain d5u7ia_: 5u7i A: [336198]
    automated match to d4d09a_
    complexed with 7xs, mg, zn

Details for d5u7ia_

PDB Entry: 5u7i (more details), 2 Å

PDB Description: pde2 catalytic domain complexed with inhibitors
PDB Compounds: (A:) cGMP-dependent 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5u7ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u7ia_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcpt
larfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdl
dhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrml
dlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkt
trkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlf
pkaaelyervasnrehwtkvshkftirglpsnnsldfl

SCOPe Domain Coordinates for d5u7ia_:

Click to download the PDB-style file with coordinates for d5u7ia_.
(The format of our PDB-style files is described here.)

Timeline for d5u7ia_: