SCOPe 2.08: Domain d5nbwa2: 5nbw A:108-214

Lineage for d5nbwa2 (5nbw A:108-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d5nbwa2: 5nbw A:108-214 [336191]
   Other proteins in same PDB: d5nbwa1, d5nbwb_, d5nbwh_, d5nbwl1
   automated match to d1tqbc2
   complexed with 8sk

Details for d5nbwa2

PDB Entry: 5nbw, 2.4 Å

PDB Description: crystal structure of the fab fragment 22f12 in complex with 3- hydroxybenzo[a]pyrene

PDB Compounds: (A:) Fab 22F12 (L,H)

SCOPe Domain Sequences for d5nbwa2:

Sequence; same for both SEQRES and ATOM records:

>d5nbwa2 b.1.1.2 (A:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d5nbwa2:

• d5nbwa2 first appeared in SCOPe 2.06
  
• d5nbwa2 appears in SCOPe 2.07