![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
![]() | Domain d5mwnf1: 5mwn F:1-118 [336188] Other proteins in same PDB: d5mwnd2, d5mwne2, d5mwnf2 automated match to d4ldeb_ complexed with po4 |
PDB Entry: 5mwn (more details), 2.2 Å
SCOPe Domain Sequences for d5mwnf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mwnf1 b.1.1.1 (F:1-118) automated matches {Llama (Lama glama) [TaxId: 9844]} qvqlvesggglvqaggtlklscaasgsisgivvmawyrqapgkqrelvasitsggttnya dsvkgrftiskdnaentlylrmnslkpedtavyyckaffrrdyvgydywgqgtqvtvs
Timeline for d5mwnf1: