SCOP 1.67: Domain d1rt4a1: 1rt4 A:430-542

Lineage for d1rt4a1 (1rt4 A:430-542)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (9 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (73 PDB entries)

8. Domain d1rt4a1: 1rt4 A:430-542 [33618]
   Other proteins in same PDB: d1rt4a2, d1rt4b_
   complexed with po4, uc1

Details for d1rt4a1

PDB Entry: 1rt4, 2.9 Å

PDB Description: hiv-1 reverse transcriptase complexed with uc781

SCOP Domain Sequences for d1rt4a1:

Sequence; same for both SEQRES and ATOM records:

>d1rt4a1 c.55.3.1 (A:430-542) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgi

Timeline for d1rt4a1:

• d1rt4a1 first appeared (with stable ids) in SCOP 1.55
  
• d1rt4a1 appears in SCOP 1.65
  
• d1rt4a1 appears in SCOP 1.69
  
• d1rt4a1 appears in the current release, SCOPe 2.08