SCOP 1.71: Domain d1fkpa1: 1fkp A:430-542

Lineage for d1fkpa1 (1fkp A:430-542)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (10 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (85 PDB entries)

8. Domain d1fkpa1: 1fkp A:430-542 [33617]
   Other proteins in same PDB: d1fkpa2, d1fkpb_
   complexed with nvp; mutant

Details for d1fkpa1

PDB Entry: 1fkp, 2.9 Å

PDB Description: crystal structure of nnrti resistant k103n mutant hiv-1 reverse transcriptase in complex with nevirapine

SCOP Domain Sequences for d1fkpa1:

Sequence; same for both SEQRES and ATOM records:

>d1fkpa1 c.55.3.1 (A:430-542) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgi

Timeline for d1fkpa1:

• d1fkpa1 first appeared (with stable ids) in SCOP 1.55
  
• d1fkpa1 appears in SCOP 1.69
  
• d1fkpa1 appears in SCOP 1.73
  
• d1fkpa1 appears in the current release, SCOPe 2.08