Lineage for d5nuzb1 (5nuz B:0-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744288Domain d5nuzb1: 5nuz B:0-107 [336165]
    Other proteins in same PDB: d5nuzb2, d5nuzl2
    automated match to d1h0da1
    complexed with gol, ipa, nag

Details for d5nuzb1

PDB Entry: 5nuz (more details), 1.85 Å

PDB Description: junin virus gp1 glycoprotein in complex with an antibody fab fragment
PDB Compounds: (B:) eOD01 light chain

SCOPe Domain Sequences for d5nuzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nuzb1 b.1.1.1 (B:0-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gdivltqspaslavslgqratiscrasesvddygisfmnwfqqkpgqppklliytassqg
sgvparfsgsgsgtdfslnihpmeeddtamyfcqqskevpytfgggtkleik

SCOPe Domain Coordinates for d5nuzb1:

Click to download the PDB-style file with coordinates for d5nuzb1.
(The format of our PDB-style files is described here.)

Timeline for d5nuzb1: