Lineage for d5jpjb1 (5jpj B:1-98)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024002Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries)
  8. 2024177Domain d5jpjb1: 5jpj B:1-98 [336163]
    Other proteins in same PDB: d5jpja2, d5jpjb2
    automated match to d3b5ga_

Details for d5jpjb1

PDB Entry: 5jpj (more details), 2 Å

PDB Description: crystal structure of 6ajl2-r24g
PDB Compounds: (B:) 6aJL2 protein

SCOPe Domain Sequences for d5jpjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jpjb1 b.1.1.1 (B:1-98) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfmltqphsvsespgktvtisctgssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssn

SCOPe Domain Coordinates for d5jpjb1:

Click to download the PDB-style file with coordinates for d5jpjb1.
(The format of our PDB-style files is described here.)

Timeline for d5jpjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jpjb2