SCOPe 2.08: Domain d5jpjb1: 5jpj B:1-98

Lineage for d5jpjb1 (5jpj B:1-98)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d5jpjb1: 5jpj B:1-98 [336163]
   Other proteins in same PDB: d5jpja2, d5jpjb2
   automated match to d3b5ga_

Details for d5jpjb1

PDB Entry: 5jpj, 2 Å

PDB Description: crystal structure of 6ajl2-r24g

PDB Compounds: (B:) 6aJL2 protein

SCOPe Domain Sequences for d5jpjb1:

Sequence; same for both SEQRES and ATOM records:

>d5jpjb1 b.1.1.1 (B:1-98) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfmltqphsvsespgktvtisctgssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssn

Timeline for d5jpjb1:

• d5jpjb1 first appeared in SCOPe 2.06
  
• d5jpjb1 appears in SCOPe 2.07