Lineage for d1rt5a1 (1rt5 A:430-542)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316624Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 316908Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) (S)
    consists of one domain of this fold
  5. 316909Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 316919Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)
  7. 316920Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (65 PDB entries)
  8. 316956Domain d1rt5a1: 1rt5 A:430-542 [33615]
    Other proteins in same PDB: d1rt5a2, d1rt5b_
    complexed with po4, uc2

Details for d1rt5a1

PDB Entry: 1rt5 (more details), 2.9 Å

PDB Description: hiv-1 reverse transcriptase complexed with uc10
PDB Compounds: (A:)

SCOP Domain Sequences for d1rt5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rt5a1 c.55.3.1 (A:430-542) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgi

SCOP Domain Coordinates for d1rt5a1:

Click to download the PDB-style file with coordinates for d1rt5a1.
(The format of our PDB-style files is described here.)

Timeline for d1rt5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rt5a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1rt5b_