Lineage for d5o0ba_ (5o0b A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2443142Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2443143Protein automated matches [190459] (53 species)
    not a true protein
  7. 2443293Species Mycobacterium abscessus [TaxId:561007] [312100] (12 PDB entries)
  8. 2443316Domain d5o0ba_: 5o0b A: [336138]
    automated match to d4rukb_
    complexed with 9fe

Details for d5o0ba_

PDB Entry: 5o0b (more details), 1.74 Å

PDB Description: crystal structure of phosphopantetheine adenylyltransferase from mycobacterium abcessus in complex with 3-bromo-1h-indazole-5- carboxylic acid (fragment 2)
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d5o0ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o0ba_ c.26.1.0 (A:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
mtgavcpgsfdpvtlghldvferaaaqfdevivavlinpnkagmftvderiemirestad
lpnlrvesgqgllvdfvrerglnaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
aysfvssslakevatyggdvsallpasvhqrllgklr

SCOPe Domain Coordinates for d5o0ba_:

Click to download the PDB-style file with coordinates for d5o0ba_.
(The format of our PDB-style files is described here.)

Timeline for d5o0ba_: