SCOPe 2.08: Domain d5niva1: 5niv A:2-107

Lineage for d5niva1 (5niv A:2-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5niva1: 5niv A:2-107 [336136]
   Other proteins in same PDB: d5niva2, d5nivb1, d5nivb2
   automated match to d1kegl1

Details for d5niva1

PDB Entry: 5niv, 1.5 Å

PDB Description: crystal structure of 5d3 fab

PDB Compounds: (A:) Light chain of 5D3 Fab

SCOPe Domain Sequences for d5niva1:

Sequence; same for both SEQRES and ATOM records:

>d5niva1 b.1.1.0 (A:2-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ivltqspssfsvslgdrvtisckasgyilnrlawyqqkpgnaprllisgatsletgfpsr
fsgtgsgkdytlsisslqtedvgtyycqqywstpwtfgggtkleir

Timeline for d5niva1:

• d5niva1 first appeared in SCOPe 2.06
  
• d5niva1 appears in SCOPe 2.07