Lineage for d5nb7a1 (5nb7 A:16-243)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
barrel, closed; n=6, S=8; greek-key
duplication: consists of two domains of the same foldSuperfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) 
Protein Factor D [50563] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50564] (29 PDB entries) 
Domain d5nb7a1: 5nb7 A:16-243 [336132]
Other proteins in same PDB: d5nb7a2
automated match to d1op8a_
complexed with 8nq, dms
Details for d5nb7a1
PDB Entry: 5nb7 (more details), 1.33 Å
PDB Description: complement factor d
PDB Compounds: (A:) complement factor dSCOPe Domain Sequences for d5nb7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nb7a1 b.47.1.2 (A:16-243) Factor D {Human (Homo sapiens) [TaxId: 9606]}
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla
SCOPe Domain Coordinates for d5nb7a1:
Click to download the PDB-style file with coordinates for d5nb7a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5nb7a1:
- d5nb7a1 first appeared in SCOPe 2.06
- d5nb7a1 appears in SCOPe 2.07
View in 3D
