Lineage for d1rt6a1 (1rt6 A:430-539)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488062Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 488414Superfamily c.55.3: Ribonuclease H-like [53098] (10 families) (S)
    consists of one domain of this fold
  5. 488415Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 488428Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)
  7. 488429Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (80 PDB entries)
  8. 488461Domain d1rt6a1: 1rt6 A:430-539 [33613]
    Other proteins in same PDB: d1rt6a2, d1rt6b1

Details for d1rt6a1

PDB Entry: 1rt6 (more details), 2.8 Å

PDB Description: hiv-1 reverse transcriptase complexed with uc38

SCOP Domain Sequences for d1rt6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rt6a1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpah

SCOP Domain Coordinates for d1rt6a1:

Click to download the PDB-style file with coordinates for d1rt6a1.
(The format of our PDB-style files is described here.)

Timeline for d1rt6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rt6a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1rt6b1