SCOPe 2.06: Domain d5nbaa1: 5nba A:16-243

Lineage for d5nbaa1 (5nba A:16-243)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein automated matches [190044] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187233] (146 PDB entries)

8. Domain d5nbaa1: 5nba A:16-243 [336125]
   Other proteins in same PDB: d5nbaa2
   automated match to d1op8a_
   complexed with 8s5

Details for d5nbaa1

PDB Entry: 5nba, 1.87 Å

PDB Description: complement factor d in complex with the inhibitor (2s,4r)-4-fluoro- pyrrolidine-1,2-dicarboxylic acid 1-[(1-carbamoyl-1h-indol-3-yl)- amide] 2-[(3-trifluoromethoxy-phenyl)-amide]

PDB Compounds: (A:) complement factor d

SCOPe Domain Sequences for d5nbaa1:

Sequence, based on SEQRES records:

>d5nbaa1 b.47.1.2 (A:16-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla

Sequence, based on observed residues (ATOM records):

>d5nbaa1 b.47.1.2 (A:16-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahclekvqvllgahslsqpep
skrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapgtlcdv
agwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsckgdsgg
plvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla

Timeline for d5nbaa1:

• d5nbaa1 is new in SCOPe 2.06-stable
  
• d5nbaa1 appears in SCOPe 2.07
  
• d5nbaa1 appears in the current release, SCOPe 2.08