Lineage for d5mwnd1 (5mwn D:1-118)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743978Domain d5mwnd1: 5mwn D:1-118 [336123]
    Other proteins in same PDB: d5mwnd2, d5mwne2, d5mwnf2
    automated match to d4ldeb_
    complexed with po4

Details for d5mwnd1

PDB Entry: 5mwn (more details), 2.2 Å

PDB Description: structure of the eaec t6ss component tssk n-terminal domain in complex with llama nanobodies nbk18 and nbk27
PDB Compounds: (D:) llama nanobody raised against TssK, nbK18

SCOPe Domain Sequences for d5mwnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mwnd1 b.1.1.1 (D:1-118) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggtlklscaasgsisgivvmawyrqapgkqrelvasitsggttnya
dsvkgrftiskdnaentlylrmnslkpedtavyyckaffrrdyvgydywgqgtqvtvs

SCOPe Domain Coordinates for d5mwnd1:

Click to download the PDB-style file with coordinates for d5mwnd1.
(The format of our PDB-style files is described here.)

Timeline for d5mwnd1: