![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
![]() | Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
![]() | Protein automated matches [190459] (52 species) not a true protein |
![]() | Species Mycobacterium abscessus [TaxId:561007] [312100] (12 PDB entries) |
![]() | Domain d5o08b_: 5o08 B: [336122] Other proteins in same PDB: d5o08c2 automated match to d4rukb_ complexed with cod, edo |
PDB Entry: 5o08 (more details), 1.55 Å
SCOPe Domain Sequences for d5o08b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o08b_ c.26.1.0 (B:) automated matches {Mycobacterium abscessus [TaxId: 561007]} mtgavcpgsfdpvtlghldvferaaaqfdevivavlinpnkagmftvderiemirestad lpnlrvesgqgllvdfvrerglnaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap aysfvssslakevatyggdvsallpasvhqrllgklr
Timeline for d5o08b_: