Lineage for d5o0ac_ (5o0a C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2469071Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2469072Protein automated matches [190459] (59 species)
    not a true protein
  7. 2469245Species Mycobacterium abscessus [TaxId:561007] [312100] (12 PDB entries)
  8. 2469273Domain d5o0ac_: 5o0a C: [336118]
    automated match to d4rukb_
    complexed with 9fh

Details for d5o0ac_

PDB Entry: 5o0a (more details), 1.81 Å

PDB Description: crystal structure of phosphopantetheine adenylyltransferase from mycobacterium abcessus in complex with 5-methyl-1-phenyl-pyrazole-4- carboxylic acid (fragment 1)
PDB Compounds: (C:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d5o0ac_:

Sequence, based on SEQRES records: (download)

>d5o0ac_ c.26.1.0 (C:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
mtgavcpgsfdpvtlghldvferaaaqfdevivavlinpnkagmftvderiemirestad
lpnlrvesgqgllvdfvrerglnaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
aysfvssslakevatyggdvsallpasvhqrllgklr

Sequence, based on observed residues (ATOM records): (download)

>d5o0ac_ c.26.1.0 (C:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
mtgavcpgsfdpvtlghldvferaaaqfdevivavliagmftvderiemirestadlpnl
rvesgqgllvdfvrerglnaivkglrtgtdfeyelqmaqmnkhiagvdtffvatapaysf
vssslakevatyggdvsallpasvhqrllgklr

SCOPe Domain Coordinates for d5o0ac_:

Click to download the PDB-style file with coordinates for d5o0ac_.
(The format of our PDB-style files is described here.)

Timeline for d5o0ac_: