Lineage for d5m2wa1 (5m2w A:1-118)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743729Domain d5m2wa1: 5m2w A:1-118 [336115]
    Other proteins in same PDB: d5m2wa2, d5m2wb2
    automated match to d4ldeb_
    complexed with so4

Details for d5m2wa1

PDB Entry: 5m2w (more details), 1.5 Å

PDB Description: structure of nanobody nb18 raised against tssk from e. coli t6ss
PDB Compounds: (A:) Llama nanobody nb8 against TssK from T6SS

SCOPe Domain Sequences for d5m2wa1:

Sequence, based on SEQRES records: (download)

>d5m2wa1 b.1.1.1 (A:1-118) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggtlklscaasgsisgivvmawyrqapgkqrelvasitsggttnya
dsvkgrftiskdnaentlylrmnslkpedtavyyckaffrrdyvgydywgqgtqvtvs

Sequence, based on observed residues (ATOM records): (download)

>d5m2wa1 b.1.1.1 (A:1-118) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggtlklscaasgsgivvmawyrqapgkqrelvasitsggttnyads
vkgrftiskdnaentlylrmnslkpedtavyyckaffrrdyvgydywgqgtqvtvs

SCOPe Domain Coordinates for d5m2wa1:

Click to download the PDB-style file with coordinates for d5m2wa1.
(The format of our PDB-style files is described here.)

Timeline for d5m2wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5m2wa2