SCOPe 2.08: Domain d5m2wa1: 5m2w A:1-118

Lineage for d5m2wa1 (5m2w A:1-118)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d5m2wa1: 5m2w A:1-118 [336115]
   Other proteins in same PDB: d5m2wa2, d5m2wb2
   automated match to d4ldeb_
   complexed with so4

Details for d5m2wa1

PDB Entry: 5m2w, 1.5 Å

PDB Description: structure of nanobody nb18 raised against tssk from e. coli t6ss

PDB Compounds: (A:) Llama nanobody nb8 against TssK from T6SS

SCOPe Domain Sequences for d5m2wa1:

Sequence, based on SEQRES records:

>d5m2wa1 b.1.1.1 (A:1-118) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggtlklscaasgsisgivvmawyrqapgkqrelvasitsggttnya
dsvkgrftiskdnaentlylrmnslkpedtavyyckaffrrdyvgydywgqgtqvtvs

Sequence, based on observed residues (ATOM records):

>d5m2wa1 b.1.1.1 (A:1-118) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggtlklscaasgsgivvmawyrqapgkqrelvasitsggttnyads
vkgrftiskdnaentlylrmnslkpedtavyyckaffrrdyvgydywgqgtqvtvs

Timeline for d5m2wa1:

• d5m2wa1 first appeared in SCOPe 2.06
  
• d5m2wa1 appears in SCOPe 2.07