SCOPe 2.06: Domain d1dtta1: 1dtt A:430-543

Lineage for d1dtta1 (1dtt A:430-543)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (104 PDB entries)
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595

8. Domain d1dtta1: 1dtt A:430-543 [33611]
   Other proteins in same PDB: d1dtta2, d1dttb_
   complexed with ftc

Details for d1dtta1

PDB Entry: 1dtt, 3 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with pett-2 (pett130a94)

PDB Compounds: (A:) hiv-1 rt a-chain

SCOPe Domain Sequences for d1dtta1:

Sequence; same for both SEQRES and ATOM records:

>d1dtta1 c.55.3.1 (A:430-543) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgig

Timeline for d1dtta1:

• d1dtta1 first appeared (with stable ids) in SCOP 1.55
  
• d1dtta1 appears in SCOPe 2.05
  
• d1dtta1 appears in SCOPe 2.07
  
• d1dtta1 appears in the current release, SCOPe 2.08