Lineage for d5mwnn_ (5mwn N:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (170 PDB entries)
  8. 2347830Domain d5mwnn_: 5mwn N: [336109]
    Other proteins in same PDB: d5mwnd2, d5mwne2, d5mwnf2
    automated match to d4ldeb_
    complexed with po4

Details for d5mwnn_

PDB Entry: 5mwn (more details), 2.2 Å

PDB Description: structure of the eaec t6ss component tssk n-terminal domain in complex with llama nanobodies nbk18 and nbk27
PDB Compounds: (N:) llama nanobody raised against TssK, nbK27

SCOPe Domain Sequences for d5mwnn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mwnn_ b.1.1.1 (N:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqpggslrlscaasgimlgyftmawyrqapgkqrelvateisggsanya
davkgrftisrdnarstvylqmnslkpedtavyycdariwrgtvydnisgpgtqvtv

SCOPe Domain Coordinates for d5mwnn_:

Click to download the PDB-style file with coordinates for d5mwnn_.
(The format of our PDB-style files is described here.)

Timeline for d5mwnn_: