SCOPe 2.08: Domain d5lhrb1: 5lhr B:6-121

Lineage for d5lhrb1 (5lhr B:6-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)

8. Domain d5lhrb1: 5lhr B:6-121 [336092]
   Other proteins in same PDB: d5lhra_, d5lhrb2
   automated match to d1mqkh_

Details for d5lhrb1

PDB Entry: 5lhr, 2.3 Å

PDB Description: the catalytic domain of murine urokinase-type plasminogen activator in complex with the active site binding inhibitory nanobody nb22

PDB Compounds: (B:) Camelid-Derived Antibody Fragment Nb22

SCOPe Domain Sequences for d5lhrb1:

Sequence, based on SEQRES records:

>d5lhrb1 b.1.1.1 (B:6-121) automated matches {Vicugna pacos [TaxId: 30538]}
esggglvqaggslrlscaasgrtfssyvmgwfrqapgkerefvaaiswsggstnyadsvk
grftisrdnakntvylqmnslkpedtavyycaadlassrdvsswywgqgtqvtvss

Sequence, based on observed residues (ATOM records):

>d5lhrb1 b.1.1.1 (B:6-121) automated matches {Vicugna pacos [TaxId: 30538]}
esggglvqaggslrlscaasssyvmgwfrqapgkerefvaaiswsggstnyadsvkgrft
isrdnakntvylqmnslkpedtavyycaadlassrdvsswywgqgtqvtvss

Timeline for d5lhrb1:

• d5lhrb1 first appeared in SCOPe 2.06, called d5lhrb_
  
• d5lhrb1 appears in SCOPe 2.07