SCOPe 2.08: Domain d5lhpb1: 5lhp B:6-135

Lineage for d5lhpb1 (5lhp B:6-135)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [276396] (23 PDB entries)

8. Domain d5lhpb1: 5lhp B:6-135 [336074]
   Other proteins in same PDB: d5lhpa_, d5lhpb2
   automated match to d3cx5j_
   complexed with edo, pbz, so4

Details for d5lhpb1

PDB Entry: 5lhp, 2.63 Å

PDB Description: the p-aminobenzamidine active site inhibited catalytic domain of murine urokinase-type plasminogen activator in complex with the allosteric inhibitory nanobody nb7

PDB Compounds: (B:) Camelid-Derived Antibody Fragment

SCOPe Domain Sequences for d5lhpb1:

Sequence; same for both SEQRES and ATOM records:

>d5lhpb1 b.1.1.0 (B:6-135) automated matches {Vicugna pacos [TaxId: 30538]}
esggglvqpggslrlscaasgftlgyyaigwfrrapgkeregvscisssggstnyadsvk
grftisrdnakntvdlqmnslkpedtaiyycaaewvppgygatvqalcnnagygmeywgk
gtqvtvssaa

Timeline for d5lhpb1:

• d5lhpb1 first appeared in SCOPe 2.06, called d5lhpb_
  
• d5lhpb1 appears in SCOPe 2.07