Lineage for d5n7ja2 (5n7j A:555-628)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2400339Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2400340Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2400933Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2400934Protein automated matches [226835] (34 species)
    not a true protein
  7. 2401069Species Neisseria polysaccharea [TaxId:489] [226281] (7 PDB entries)
  8. 2401075Domain d5n7ja2: 5n7j A:555-628 [336072]
    Other proteins in same PDB: d5n7ja1, d5n7ja3
    automated match to d1g5aa1
    complexed with 1pe, mlr, pg4, suc, trs; mutant

Details for d5n7ja2

PDB Entry: 5n7j (more details), 2 Å

PDB Description: crystal structure of neisseria polysaccharea amylosucrase mutant efficient for the synthesis of controlled size maltooligosaccharides
PDB Compounds: (A:) amylosucrase

SCOPe Domain Sequences for d5n7ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n7ja2 b.71.1.0 (A:555-628) automated matches {Neisseria polysaccharea [TaxId: 489]}
rlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfkahdliggktvslnqd
ltlqpyqvmwleia

SCOPe Domain Coordinates for d5n7ja2:

Click to download the PDB-style file with coordinates for d5n7ja2.
(The format of our PDB-style files is described here.)

Timeline for d5n7ja2: