Lineage for d5lqva_ (5lqv A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714860Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2714861Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 2714949Family a.52.1.0: automated matches [254196] (1 protein)
    not a true family
  6. 2714950Protein automated matches [254428] (8 species)
    not a true protein
  7. 2714962Species Common lentil (Lens culinaris) [TaxId:3864] [255496] (3 PDB entries)
  8. 2714963Domain d5lqva_: 5lqv A: [336060]
    automated match to d2mala_
    complexed with pgm

Details for d5lqva_

PDB Entry: 5lqv (more details)

PDB Description: spatial structure of the lentil lipid transfer protein in complex with anionic lysolipid lppg
PDB Compounds: (A:) Non-specific lipid-transfer protein 2

SCOPe Domain Sequences for d5lqva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lqva_ a.52.1.0 (A:) automated matches {Common lentil (Lens culinaris) [TaxId: 3864]}
aiscgavtsdlspcltyltggpgpspqccggvkkllaaanttpdrqaacnclksaagsit
klntnnaaalpgkcgvnipykistttncntvkf

SCOPe Domain Coordinates for d5lqva_:

Click to download the PDB-style file with coordinates for d5lqva_.
(The format of our PDB-style files is described here.)

Timeline for d5lqva_: