SCOPe 2.08: Domain d5n2fb1: 5n2f B:18-134

Lineage for d5n2fb1 (5n2f B:18-134)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5n2fb1: 5n2f B:18-134 [336058]
   Other proteins in same PDB: d5n2fa2, d5n2fb2
   automated match to d3bova_
   complexed with 8hw

Details for d5n2fb1

PDB Entry: 5n2f, 1.7 Å

PDB Description: structure of pd-l1/small-molecule inhibitor complex

PDB Compounds: (B:) Programmed cell death 1 ligand 1

SCOPe Domain Sequences for d5n2fb1:

Sequence; same for both SEQRES and ATOM records:

>d5n2fb1 b.1.1.0 (B:18-134) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aftvtvpkdlyvveygsnmtieckfpvekqldlaalivywemedkniiqfvhgeedlkvq
hssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnapy

Timeline for d5n2fb1:

• d5n2fb1 first appeared in SCOPe 2.06
  
• d5n2fb1 appears in SCOPe 2.07