Lineage for d5n2fb1 (5n2f B:18-134)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754993Domain d5n2fb1: 5n2f B:18-134 [336058]
    Other proteins in same PDB: d5n2fa2, d5n2fb2
    automated match to d3bova_
    complexed with 8hw

Details for d5n2fb1

PDB Entry: 5n2f (more details), 1.7 Å

PDB Description: structure of pd-l1/small-molecule inhibitor complex
PDB Compounds: (B:) Programmed cell death 1 ligand 1

SCOPe Domain Sequences for d5n2fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n2fb1 b.1.1.0 (B:18-134) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aftvtvpkdlyvveygsnmtieckfpvekqldlaalivywemedkniiqfvhgeedlkvq
hssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnapy

SCOPe Domain Coordinates for d5n2fb1:

Click to download the PDB-style file with coordinates for d5n2fb1.
(The format of our PDB-style files is described here.)

Timeline for d5n2fb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5n2fb2