SCOPe 2.08: Domain d5gizb1: 5giz B:40-305

Lineage for d5gizb1 (5giz B:40-305)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.0: automated matches [191548] (1 protein)
   not a true family

6. Protein automated matches [190944] (40 species)
   not a true protein

7. Species Burkholderia cenocepacia [TaxId:216591] [335925] (3 PDB entries)

8. Domain d5gizb1: 5giz B:40-305 [336051]
   Other proteins in same PDB: d5giza2, d5gizb2
   automated match to d2r7ab_
   complexed with cl, so4

Details for d5gizb1

PDB Entry: 5giz, 1.5 Å

PDB Description: periplasmic heme-binding protein bhut in apo form

PDB Compounds: (B:) Putative hemin transport system, substrate-binding protein

SCOPe Domain Sequences for d5gizb1:

Sequence; same for both SEQRES and ATOM records:

>d5gizb1 c.92.2.0 (B:40-305) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
krviviggalaetafalggaetpryrlvgadttctypdaakrlpkvgyqralsaegllsl
rpdlvlasaeagpptaiaqvkgagvtvttfderhdvesvrakitgvaqaldvrdagaall
qrfdrdwqaardavaarvpggaqpprvlfvlnhtgtqalvagqrtaadamiryagarnam
qgfdhykplttealaaaapdvvlisdeglaavgghaallatpgfgatpagrarrvvslda
lfllgfgprlplavttlhrrlsdala

Timeline for d5gizb1:

• d5gizb1 first appeared in SCOPe 2.06
  
• d5gizb1 appears in SCOPe 2.07