Lineage for d1c1ba1 (1c1b A:430-543)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71788Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 72015Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) (S)
  5. 72016Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 72026Protein HIV RNase H (Domain of reverse transcriptase) [53105] (1 species)
  7. 72027Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (50 PDB entries)
  8. 72031Domain d1c1ba1: 1c1b A:430-543 [33605]
    Other proteins in same PDB: d1c1ba2, d1c1bb1

Details for d1c1ba1

PDB Entry: 1c1b (more details), 2.5 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with gca-186

SCOP Domain Sequences for d1c1ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c1ba1 c.55.3.1 (A:430-543) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgig

SCOP Domain Coordinates for d1c1ba1:

Click to download the PDB-style file with coordinates for d1c1ba1.
(The format of our PDB-style files is described here.)

Timeline for d1c1ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c1ba2
View in 3D
Domains from other chains:
(mouse over for more information)
d1c1bb1