SCOP 1.55: Domain d1c1ba1: 1c1b A:430-543

Lineage for d1c1ba1 (1c1b A:430-543)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.3: Ribonuclease H-like [53098] (6 families)

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (41 PDB entries)

8. Domain d1c1ba1: 1c1b A:430-543 [33605]
   Other proteins in same PDB: d1c1ba2, d1c1bb1

Details for d1c1ba1

PDB Entry: 1c1b, 2.5 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with gca-186

SCOP Domain Sequences for d1c1ba1:

Sequence; same for both SEQRES and ATOM records:

>d1c1ba1 c.55.3.1 (A:430-543) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgig

Timeline for d1c1ba1:

• d1c1ba1 appears in SCOP 1.57
  
• d1c1ba1 appears in the current release, SCOPe 2.08