![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
![]() | Superfamily d.13.1: HIT-like [54197] (6 families) ![]() |
![]() | Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins) Pfam PF01230 topologically similar to the N-terminal domain of protein kinases |
![]() | Protein Histidine triad nucleotide-binding protein (HINT) [54199] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [224916] (19 PDB entries) |
![]() | Domain d5klyb_: 5kly B: [336031] automated match to d3tw2a_ complexed with 6ur, cl, peg; mutant |
PDB Entry: 5kly (more details), 1.3 Å
SCOPe Domain Sequences for d5klyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5klyb_ d.13.1.1 (B:) Histidine triad nucleotide-binding protein (HINT) {Human (Homo sapiens) [TaxId: 9606]} gdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesll ghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvnlhvlggrqmhwppg
Timeline for d5klyb_: