![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
![]() | Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) ![]() |
![]() | Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins) automatically mapped to Pfam PF02216 |
![]() | Protein automated matches [191290] (4 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [189943] (15 PDB entries) |
![]() | Domain d5h7bb1: 5h7b B:38-86 [336027] automated match to d2otke_ |
PDB Entry: 5h7b (more details), 3.1 Å
SCOPe Domain Sequences for d5h7bb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h7bb1 a.8.1.1 (B:38-86) automated matches {Staphylococcus aureus [TaxId: 1280]} eqqnafyeilhlpnlneeqrnafiqslkddpsqsanllaeakklneqqa
Timeline for d5h7bb1: