Class b: All beta proteins [48724] (178 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
Protein automated matches [226927] (18 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [256346] (16 PDB entries) |
Domain d5kjya_: 5kjy A: [336015] automated match to d4ku7a_ complexed with cmp; mutant |
PDB Entry: 5kjy (more details), 2 Å
SCOPe Domain Sequences for d5kjya_:
Sequence, based on SEQRES records: (download)
>d5kjya_ b.82.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} stlrkrkmyeeflskvsilesldkwerltvadalepvqfedgqkivvqgepgdeffiile gsaavlqrrseneefvevrrlgpsdyfgeiallmnrprtatvvargplkcvkldrprfer vlgpcsdilkrniqqynsfvsl
>d5kjya_ b.82.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} stlrkrkmyeeflskvsilesldkwerltvadalepvqfedgqkivvqgepgdeffiile gsaavlqrrseefvevrrlgpsdyfgeiallmnrprtatvvargplkcvkldrprfervl gpcsdilkrniqqynsfvsl
Timeline for d5kjya_: