Lineage for d5kjya_ (5kjy A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2426017Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2426259Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2426260Protein automated matches [226927] (18 species)
    not a true protein
  7. 2426288Species Human (Homo sapiens) [TaxId:9606] [256346] (16 PDB entries)
  8. 2426305Domain d5kjya_: 5kjy A: [336015]
    automated match to d4ku7a_
    complexed with cmp; mutant

Details for d5kjya_

PDB Entry: 5kjy (more details), 2 Å

PDB Description: co-crystal structure of pka ri alpha cnb-b mutant (g316r/a336t) with camp
PDB Compounds: (A:) cAMP-dependent protein kinase type I-alpha regulatory subunit

SCOPe Domain Sequences for d5kjya_:

Sequence, based on SEQRES records: (download)

>d5kjya_ b.82.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stlrkrkmyeeflskvsilesldkwerltvadalepvqfedgqkivvqgepgdeffiile
gsaavlqrrseneefvevrrlgpsdyfgeiallmnrprtatvvargplkcvkldrprfer
vlgpcsdilkrniqqynsfvsl

Sequence, based on observed residues (ATOM records): (download)

>d5kjya_ b.82.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stlrkrkmyeeflskvsilesldkwerltvadalepvqfedgqkivvqgepgdeffiile
gsaavlqrrseefvevrrlgpsdyfgeiallmnrprtatvvargplkcvkldrprfervl
gpcsdilkrniqqynsfvsl

SCOPe Domain Coordinates for d5kjya_:

Click to download the PDB-style file with coordinates for d5kjya_.
(The format of our PDB-style files is described here.)

Timeline for d5kjya_: