Lineage for d5kjza1 (5kjz A:234-381)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2405483Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2405722Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2405723Protein automated matches [226927] (16 species)
    not a true protein
  7. 2405748Species Human (Homo sapiens) [TaxId:9606] [256346] (16 PDB entries)
  8. 2405750Domain d5kjza1: 5kjz A:234-381 [336011]
    Other proteins in same PDB: d5kjza2
    automated match to d4ku7a_
    complexed with gol, pcg; mutant

Details for d5kjza1

PDB Entry: 5kjz (more details), 1.35 Å

PDB Description: co-crystal structure of pka ri alpha cnb-b mutant (g316r/a336t) with cgmp
PDB Compounds: (A:) cAMP-dependent protein kinase type I-alpha regulatory subunit

SCOPe Domain Sequences for d5kjza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kjza1 b.82.3.0 (A:234-381) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ilmgstlrkrkmyeeflskvsilesldkwerltvadalepvqfedgqkivvqgepgdeff
iilegsaavlqrrseneefvevrrlgpsdyfgeiallmnrprtatvvargplkcvkldrp
rfervlgpcsdilkrniqqynsfvslsv

SCOPe Domain Coordinates for d5kjza1:

Click to download the PDB-style file with coordinates for d5kjza1.
(The format of our PDB-style files is described here.)

Timeline for d5kjza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5kjza2