SCOP 1.65: Domain d1hvua1: 1hvu A:430-554

Lineage for d1hvua1 (1hvu A:430-554)

Root: SCOP 1.65
Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.3: Ribonuclease H-like [53098] (7 families)
consists of one domain of this fold
Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)
Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (65 PDB entries)
Domain d1hvua1: 1hvu A:430-554 [33600]
Other proteins in same PDB: d1hvua2, d1hvub_, d1hvud2, d1hvue_, d1hvug2, d1hvuh_, d1hvuj2, d1hvuk_

Details for d1hvua1

PDB Entry: 1hvu (more details), 4.75 Å

PDB Description: human immunodeficiency virus type 1 reverse transcriptase complexed with a 33-base nucleotide rna pseudoknot

SCOP Domain Sequences for d1hvua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hvua1 c.55.3.1 (A:430-554) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

SCOP Domain Coordinates for d1hvua1:

Click to download the PDB-style file with coordinates for d1hvua1.
(The format of our PDB-style files is described here.)

Timeline for d1hvua1: