Lineage for d5isqx_ (5isq X:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2511486Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2511487Protein automated matches [190777] (27 species)
    not a true protein
  7. 2511735Species Staphylococcus aureus [TaxId:1280] [188848] (13 PDB entries)
  8. 2511749Domain d5isqx_: 5isq X: [335996]
    automated match to d3i8ax_
    complexed with gol, nap, u06; mutant

Details for d5isqx_

PDB Entry: 5isq (more details), 1.9 Å

PDB Description: staphylococcus aureus h30n, f98y dihydrofolate reductase mutant complexed with beta-nadph and 3'-(3-(2,4-diamino-6-ethylpyrimidin-5- yl)prop-2-yn-1-yl)-4'-methoxy-[1,1'-biphenyl]-4-carboxylic acid (ucp1106)
PDB Compounds: (X:) dihydrofolate reductase

SCOPe Domain Sequences for d5isqx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5isqx_ c.71.1.0 (X:) automated matches {Staphylococcus aureus [TaxId: 1280]}
tlsilvahdlqrvigfenqlpwhlpndlknvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlyeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk

SCOPe Domain Coordinates for d5isqx_:

Click to download the PDB-style file with coordinates for d5isqx_.
(The format of our PDB-style files is described here.)

Timeline for d5isqx_: