Lineage for d1bqna1 (1bqn A:430-558)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 586264Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 586646Superfamily c.55.3: Ribonuclease H-like [53098] (10 families) (S)
    consists of one domain of this fold
  5. 586647Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 586660Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)
  7. 586661Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (85 PDB entries)
  8. 586745Domain d1bqna1: 1bqn A:430-558 [33599]
    Other proteins in same PDB: d1bqna2, d1bqnb_
    complexed with hby; mutant

Details for d1bqna1

PDB Entry: 1bqn (more details), 3.3 Å

PDB Description: tyr 188 leu hiv-1 rt/hby 097

SCOP Domain Sequences for d1bqna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqna1 c.55.3.1 (A:430-558) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggnqqvd
klvsagirk

SCOP Domain Coordinates for d1bqna1:

Click to download the PDB-style file with coordinates for d1bqna1.
(The format of our PDB-style files is described here.)

Timeline for d1bqna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bqna2
View in 3D
Domains from other chains:
(mouse over for more information)
d1bqnb_