Lineage for d3hvta1 (3hvt A:430-556)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995888Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 995889Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 995925Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)
  7. 995926Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (85 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 996014Domain d3hvta1: 3hvt A:430-556 [33598]
    Other proteins in same PDB: d3hvta2, d3hvtb_
    complexed with nvp

Details for d3hvta1

PDB Entry: 3hvt (more details), 2.9 Å

PDB Description: structural basis of asymmetry in the human immunodeficiency virus type 1 reverse transcriptase heterodimer
PDB Compounds: (A:) hiv-1 reverse transcriptase (subunit p66)

SCOPe Domain Sequences for d3hvta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hvta1 c.55.3.1 (A:430-556) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagi

SCOPe Domain Coordinates for d3hvta1:

Click to download the PDB-style file with coordinates for d3hvta1.
(The format of our PDB-style files is described here.)

Timeline for d3hvta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hvta2
View in 3D
Domains from other chains:
(mouse over for more information)
d3hvtb_