SCOP 1.73: Domain d1bqma1: 1bqm A:430-556

Lineage for d1bqma1 (1bqm A:430-556)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (12 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (4 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (85 PDB entries)

8. Domain d1bqma1: 1bqm A:430-556 [33597]
   Other proteins in same PDB: d1bqma2, d1bqmb_
   complexed with hby; mutant

Details for d1bqma1

PDB Entry: 1bqm, 3.1 Å

PDB Description: hiv-1 rt/hby 097

PDB Compounds: (A:) reverse transcriptase

SCOP Domain Sequences for d1bqma1:

Sequence; same for both SEQRES and ATOM records:

>d1bqma1 c.55.3.1 (A:430-556) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagi

Timeline for d1bqma1:

• d1bqma1 first appeared (with stable ids) in SCOP 1.55
  
• d1bqma1 appears in SCOP 1.71
  
• d1bqma1 appears in SCOP 1.75
  
• d1bqma1 appears in the current release, SCOPe 2.08