SCOPe 2.07: Domain d1uwba1: 1uwb A:430-558

Lineage for d1uwba1 (1uwb A:430-558)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (104 PDB entries)
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595

8. Domain d1uwba1: 1uwb A:430-558 [33596]
   Other proteins in same PDB: d1uwba2, d1uwbb_
   complexed with tbo

Details for d1uwba1

PDB Entry: 1uwb, 3.2 Å

PDB Description: tyr 181 cys hiv-1 rt/8-cl tibo

PDB Compounds: (A:) reverse transcriptase

SCOPe Domain Sequences for d1uwba1:

Sequence; same for both SEQRES and ATOM records:

>d1uwba1 c.55.3.1 (A:430-558) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagirk

Timeline for d1uwba1:

• d1uwba1 first appeared (with stable ids) in SCOP 1.55
  
• d1uwba1 appears in SCOPe 2.06
  
• d1uwba1 appears in the current release, SCOPe 2.08