| Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) |
Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) ![]() |
| Family c.55.3.1: Ribonuclease H [53099] (3 proteins) |
| Protein HIV RNase H (Domain of reverse transcriptase) [53105] (1 species) |
| Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (41 PDB entries) |
| Domain d1uwba1: 1uwb A:430-558 [33596] Other proteins in same PDB: d1uwba2, d1uwbb1 |
PDB Entry: 1uwb (more details), 3.2 Å
SCOP Domain Sequences for d1uwba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uwba1 c.55.3.1 (A:430-558) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagirk
Timeline for d1uwba1: