Lineage for d5h79d1 (5h79 D:36-78)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2696963Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 2696964Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 2696965Protein Immunoglobulin-binding protein A modules [46999] (1 species)
  7. 2696966Species Staphylococcus aureus [TaxId:1280] [47000] (27 PDB entries)
  8. 2696988Domain d5h79d1: 5h79 D:36-78 [335942]
    automated match to d1fc2c_

Details for d5h79d1

PDB Entry: 5h79 (more details), 2.7 Å

PDB Description: crystal structure of a repeat protein with three protein a repeat module
PDB Compounds: (D:) Immunoglobulin G-binding protein A

SCOPe Domain Sequences for d5h79d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h79d1 a.8.1.1 (D:36-78) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]}
nkeqqnafyeilhlpnlneeqrnafiqslkddpsqsanllaea

SCOPe Domain Coordinates for d5h79d1:

Click to download the PDB-style file with coordinates for d5h79d1.
(The format of our PDB-style files is described here.)

Timeline for d5h79d1: