Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88585] (57 PDB entries) Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region |
Domain d5gsqd1: 5gsq D:240-339 [335934] Other proteins in same PDB: d5gsqa2, d5gsqb2, d5gsqc2, d5gsqd2 automated match to d1hzhk3 complexed with bma, gal, man, nag, sia |
PDB Entry: 5gsq (more details), 1.85 Å
SCOPe Domain Sequences for d5gsqd1:
Sequence, based on SEQRES records: (download)
>d5gsqd1 b.1.1.2 (D:240-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]} vflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynst yrvvsvltvlhqdwlngkeykckvsnkalpapiektiska
>d5gsqd1 b.1.1.2 (D:240-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]} vflfppkpkdtlmisrtpevtcvvvddpevkfnwyvdgvevhnaktkprenstyrvvsvl tvlhqdwlngkeykckvspapiektiska
Timeline for d5gsqd1: