Lineage for d5h5ka_ (5h5k A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128241Species Aquifex aeolicus [TaxId:224324] [188217] (15 PDB entries)
  8. 2128264Domain d5h5ka_: 5h5k A: [335929]
    automated match to d4s35b_
    complexed with atp, c5p, edo, mg

Details for d5h5ka_

PDB Entry: 5h5k (more details), 2.3 Å

PDB Description: atp and cmp bound crystal structure of thymidylate kinase (aq_969) from aquifex aeolicus vf5
PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d5h5ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h5ka_ c.37.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}
mliafegidgsgkttqakklyeylkqkgyfvslyrepggtkvgevlreillteelderte
lllfeasrsklieekiipdlkrdkvvildrfvlstiayqgygkgldvefiknlnefatrg
vkpditllldipvdialrrlkeknrfenkeflekvrkgflelakeeenvvvidasgeeee
vfkeilralsgvl

SCOPe Domain Coordinates for d5h5ka_:

Click to download the PDB-style file with coordinates for d5h5ka_.
(The format of our PDB-style files is described here.)

Timeline for d5h5ka_: