Lineage for d5giza1 (5giz A:40-305)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912348Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2912730Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2912731Protein automated matches [190944] (40 species)
    not a true protein
  7. 2912749Species Burkholderia cenocepacia [TaxId:216591] [335925] (3 PDB entries)
  8. 2912750Domain d5giza1: 5giz A:40-305 [335927]
    Other proteins in same PDB: d5giza2, d5gizb2
    automated match to d2r7ab_
    complexed with cl, so4

Details for d5giza1

PDB Entry: 5giz (more details), 1.5 Å

PDB Description: periplasmic heme-binding protein bhut in apo form
PDB Compounds: (A:) Putative hemin transport system, substrate-binding protein

SCOPe Domain Sequences for d5giza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5giza1 c.92.2.0 (A:40-305) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
krviviggalaetafalggaetpryrlvgadttctypdaakrlpkvgyqralsaegllsl
rpdlvlasaeagpptaiaqvkgagvtvttfderhdvesvrakitgvaqaldvrdagaall
qrfdrdwqaardavaarvpggaqpprvlfvlnhtgtqalvagqrtaadamiryagarnam
qgfdhykplttealaaaapdvvlisdeglaavgghaallatpgfgatpagrarrvvslda
lfllgfgprlplavttlhrrlsdala

SCOPe Domain Coordinates for d5giza1:

Click to download the PDB-style file with coordinates for d5giza1.
(The format of our PDB-style files is described here.)

Timeline for d5giza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5giza2